PTF1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	pancreas specific transcription factor, 1a
Database Link	NP_835455 Entrez Gene 256297 Human UniProt ID Q7RTS3
Background	PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas. This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	bHLHa29; PACA; PAGEN2; PTF1-p48
Note	Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Mouse: 86%; Yeast: 75%
Reference Data
Protein Families	Embryonic stem cells, ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.