HP1 alpha (CBX5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	WB, IF
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	chromobox 5
Database Link	NP_036249 Entrez Gene 23468 Human UniProt ID P45973
Background	CBX5 is a methyl-lysine binding protein localized at heterochromatin sites, where it mediates gene silencing.
Synonyms	HEL25; HP1; HP1A
Note	Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.