CTBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	C-terminal binding protein 1
Database Link	NP_001319 Entrez Gene 13016 MouseEntrez Gene 1487 Human UniProt ID Q13363
Background	The phosphoprotein C-terminal binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptional repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.
Synonyms	BARS
Note	Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%
Reference Data
Protein Pathways	Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.