HACE1 Rabbit Polyclonal Antibody

CAT#: TA330454

Rabbit Polyclonal Anti-HACE1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 (HACE1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 (HACE1), 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 (HACE1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1. Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 102 kDa
Gene Name HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
Background HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.
Synonyms E3 ubiquitin protein ligase 1; HECT domain and ankyrin repeat containing
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...