RGS10 Rabbit Polyclonal Antibody

CAT#: TA330397

Rabbit Polyclonal Anti-RGS10 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 2
    • 100 ug

CN¥ 3,080.00


Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00


Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 1
    • 100 ug

CN¥ 3,080.00

Specifications

Product Data
Applications FC, WB
Recommend Dilution WB, FACS
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 21 kDa
Gene Name regulator of G-protein signaling 10
Background RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.
Synonyms OTTHUMP00000020597; OTTHUMP00000069158; regulator of G-protein signaling 10; regulator of G-protein signalling 10
Note Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%; Bovine: 81%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...