RGS10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	FC, WB
Recommend Dilution	WB, FACS
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	regulator of G-protein signaling 10
Database Link	NP_001005339 Entrez Gene 67865 MouseEntrez Gene 6001 Human UniProt ID O43665
Background	RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.
Synonyms	OTTHUMP00000020597; OTTHUMP00000069158; regulator of G-protein signaling 10; regulator of G-protein signalling 10
Note	Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%; Bovine: 81%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.