TAB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2. Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	TGF-beta activated kinase 1/MAP3K7 binding protein 2
Database Link	NP_055908 Entrez Gene 23118 Human UniProt ID Q9NYJ8
Background	MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.
Synonyms	CHTD2; MAP3K7IP2; TAB-2
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	MAPK signaling pathway, NOD-like receptor signaling pathway, Toll-like receptor signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.