SIRT3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	sirtuin 3
Database Link	NP_036371 Entrez Gene 23410 Human UniProt ID Q9NTG7
Background	SIRT3 is included in class I of the sirtuin family which is characterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.
Synonyms	SIR2L3
Note	Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.