RUVBL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	RuvB like AAA ATPase 2
Database Link	NP_006657 Entrez Gene 10856 Human UniProt ID Q9Y230
Background	RuvB-Like 2 (48-kDa TATA box-binding protein-interacting protein, Reptin 52, RUVBL2) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this protein has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
Synonyms	CGI-46; ECP51; INO80J; REPTIN; RVB2; TIH2; TIP48; TIP49B
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.