PC4 (SUB1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PC4 antibody: synthetic peptide directed towards the N terminal of human PC4. Synthetic peptide located within the following region: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	SUB1 homolog, transcriptional regulator
Database Link	NP_006704 Entrez Gene 10923 Human UniProt ID P53999
Background	PC4 is a transcriptional coactivator. General transcription factor IIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity rather than by reducing the repressive activity of PC4 via its phosphorylation
Synonyms	p14; P15; PC4
Note	Immunogen sequence homology: Bovine:100%; Human:100%; Sumatran orangutan:100%; Crab-eating macaque:100%; Dog:100%; Rat:92%; Mouse:91%; Chicken:85%; Zebra finch:84%; Body louse:78%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.