TCF4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TCF4 antibody: synthetic peptide directed towards the N terminal of human TCF4. Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	transcription factor 4
Database Link	NP_003190 Entrez Gene 6925 Human UniProt ID P15884
Background	TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.
Synonyms	bHLHb19; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Note	Immunogen sequence homology: Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.