RAB14 Rabbit Polyclonal Antibody
CAT#: TA330015
Rabbit Polyclonal Anti-RAB14 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Murine |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | RAB14, member RAS oncogene family |
Database Link | |
Background | Localized to biosynthetic and endosomal compartments, Rab14 is involved in the biosynthetic/recycling pathway between the Golgi and endosomal compartments. |
Synonyms | FBP; RAB-14 |
Note | Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |