Onecut3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Onecut3 antibody: synthetic peptide directed towards the c terminal of mouse Onecut3. Synthetic peptide located within the following region: QATISQQLGLELNTVSNFFMNARRRCMNRWAEEPGATPGTGTATATFSKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	one cut domain, family member 3
Database Link	NP_631972 Entrez Gene 246086 Mouse UniProt ID Q8K557
Background	Onecut3 is a transcriptional activator. Onecut3 binds the consensus DNA sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR.
Synonyms	OC-3; OC3
Note	Immunogen sequence homology: Mouse: 100%; Rat: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.