Lmx1a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Lmx1a antibody: synthetic peptide directed towards the middle region of mouse Lmx1a. Synthetic peptide located within the following region: KKLARRQQQQQQDQQNTQRLTSAQTNGSGNAGMEGIMNPYTTLPTPQQLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	LIM homeobox transcription factor 1 alpha
Database Link	NP_387501 Entrez Gene 110648 Mouse UniProt ID Q9JKU8
Background	Lmx1a acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Lmx1a is required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.
Synonyms	LMX-1; LMX-1.1; LMX1; LMX1.1; MGC87616; OTTHUMP00000032531
Note	Immunogen sequence homology: Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.