Foxp4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXP4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	forkhead box P4
Database Link	NP_083043 Entrez Gene 74123 Mouse UniProt ID Q9DBY0
Background	Foxp4 is a member of the murine forkhead family of transcription factors. It is expressed exclusively in the epithelial cells of the developing intestine, where, in late development, it is expressed in a gradient along the longitudinal axis of the villi.
Synonyms	FKHLA; FLJ40908; FLJ44184; hFKHLA; OTTHUMP00000043536
Note	Immunogen sequence homology: Rat: 100%; Horse: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.