Parn Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	poly(A)-specific ribonuclease (deadenylation nuclease)
Database Link	NP_083037 Entrez Gene 5073 HumanEntrez Gene 74108 Mouse UniProt ID Q8VDG3
Background	PARN is an oligomeric, processive, and cap-interacting 3' exonuclease.
Synonyms	DAN
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.