ZNF526 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF526 antibody: synthetic peptide directed towards the N terminal of human ZNF526. Synthetic peptide located within the following region: PPTPLPPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEER
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	zinc finger protein 526
Database Link	NP_597701 Entrez Gene 116115 Human UniProt ID Q8TF50
Background	ZNF526 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers. ZNF526 may be involved in transcriptional regulation.
Synonyms	DKFZp762O059; KIAA1951; MGC4267
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.