MYF6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the N terminal of human MYF6. Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	myogenic factor 6
Database Link	NP_002460 Entrez Gene 4618 Human UniProt ID P23409
Background	MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
Synonyms	bHLHc4; CNM3; MRF4; myf-6
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.