Bfar Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Bfar antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	bifunctional apoptosis regulator
Database Link	NP_080252 Entrez Gene 67118 Mouse UniProt ID Q8R079
Background	Bfar is an apoptosis regulator. It has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.
Synonyms	BAR; RNF47
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 86%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.