ZNF364 (RNF115) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF364 antibody: synthetic peptide directed towards the C terminal of human ZNF364. Synthetic peptide located within the following region: PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	ring finger protein 115
Database Link	NP_055270 Entrez Gene 27246 Human UniProt ID Q9Y4L5
Background	ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.
Synonyms	BCA2; ZNF364
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.