WWP2 Rabbit Polyclonal Antibody

CAT#: TA329808

Rabbit Polyclonal Anti-WWP2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the middle region of human WWP2. Synthetic peptide located within the following region: EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 47 kDa
Gene Name WW domain containing E3 ubiquitin protein ligase 2
Background WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Synonyms AIP2; WWp2-like
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Zebrafish: 80%
Reference Data
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...