SMAD5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	SMAD family member 5
Database Link	NP_005894 Entrez Gene 4090 Human UniProt ID Q99717
Background	SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma. Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.
Synonyms	DWFC; JV5-1; MADH5
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Zebrafish: 93%
Reference Data
Protein Families	Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors
Protein Pathways	TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.