Mrtfa Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MKL1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	106 kDa
Gene Name	MKL (megakaryoblastic leukemia)/myocardin-like 1
Database Link	NP_694629 Entrez Gene 223701 Mouse UniProt ID Q8K4J6
Background	MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Synonyms	AMKL; BSAC; KIAA1438; MAL; MRTF-A; OTTHUMP00000199247
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Human: 79%; Zebrafish: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.