B3GNT6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6
Database Link	NP_619651 Entrez Gene 192134 Human UniProt ID Q6ZMB0
Background	B3GNT6 is a beta-1,3-N-acetylglucosaminyltransferase that synthesizes the core 3 structure of the O-glycan, an important precursor in the biosynthesis of mucin-type glycoproteins. It plays an important role in the synthesis of mucin-type O-glycans in digestive organs.
Synonyms	3-Gn-T6; B3Gn-T6; beta-1; beta3Gn-T6; BGnT-6
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 93%; Rat: 92%; Dog: 86%; Pig: 86%; Bovine: 86%; Mouse: 83%
Reference Data
Protein Pathways	Metabolic pathways, O-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.