Cldn6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cldn6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	claudin 6
Database Link	NP_061247 Entrez Gene 54419 Mouse UniProt ID Q9Z262
Background	Cldn6 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Synonyms	OTTHUMP00000159248
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Pig: 88%; Bovine: 88%; Guinea pig: 88%; Horse: 81%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.