ETV2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ETV2 antibody: synthetic peptide directed towards the N terminal of human ETV2. Synthetic peptide located within the following region: DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	ETS variant 2
Database Link	NP_055024 Entrez Gene 2116 Human UniProt ID O00321
Background	The function of ETV2 remains unknown.
Synonyms	ER71; ETSRP71
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.