SIGLEC6 Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the middle region of human SIGLEC6. Synthetic peptide located within the following region: FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	sialic acid binding Ig like lectin 6
Database Link	NP_942143 Entrez Gene 946 Human UniProt ID O43699
Background	SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
Synonyms	CD33L; CD33L1; CD33L2; CD327; CDW327; OBBP1
Note	Immunogen sequence homology: Human: 100%; Horse: 93%; Dog: 91%; Pig: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 82%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.