GATA6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, IHC, WB
Recommend Dilution	WB, IF, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	GATA binding protein 6
Database Link	NP_005248 Entrez Gene 2627 Human UniProt ID Q92908
Background	GATA6 is thought to be important for regulating terminal differentiation and/or proliferation.
Synonyms	GATA-binding protein 6; GATA binding protein 6; transcription factor GATA-6
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 93%; Sheep: 93%; Rabbit: 93%; Rat: 86%; Bovine: 86%; Guinea pig: 85%; Mouse: 79%
Reference Data
Protein Families	Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.