ZBTB20 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZBTB20 antibody: synthetic peptide directed towards the middle region of human ZBTB20. Synthetic peptide located within the following region: SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	zinc finger and BTB domain containing 20
Database Link	NP_056457 Entrez Gene 26137 Human UniProt ID Q9HC78
Background	ZBTB20 is a 733-residue protein with a BTB/POZ domain at the N-terminal and 4 C2H2 zinc fingers at C-terminal. It is localized on chromosome 3. It is widely expressed in hematopoietic tissues
Synonyms	DPZF; HOF; ODA-8S; PRIMS; ZNF288
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.