KIN Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIN antibody: synthetic peptide directed towards the middle region of human KIN. Synthetic peptide located within the following region: LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	Kin17 DNA and RNA binding protein
Database Link	NP_036443 Entrez Gene 22944 Human UniProt ID O60870
Background	Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.
Synonyms	BTCD; KIN17; Rts2
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.