DHRSX Rabbit Polyclonal Antibody
CAT#: TA329372
Rabbit Polyclonal anti-DHRSX antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DHRSX antibody: synthetic peptide directed towards the C terminal of human DHRSX. Synthetic peptide located within the following region: DEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | dehydrogenase/reductase X-linked |
Database Link | |
Background | DHRSX belongs to the short-chain dehydrogenases/reductases (SDR) family. The exact function of DHRSX remains unknown. |
Synonyms | CXorf11; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR7C6; SDR46C1 |
Note | Immunogen sequence homology: Dog: 100%; Human: 93%; Pig: 92%; Guinea pig: 92%; Rat: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |