ZDHHC19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZDHHC19 antibody is: synthetic peptide directed towards the N-terminal region of Human ZDHHC19. Synthetic peptide located within the following region: FPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	zinc finger DHHC-type containing 19
Database Link	NP_001034706 Entrez Gene 131540 Human UniProt ID Q8WVZ1
Background	ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
Synonyms	DHHC19
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Horse: 92%; Rat: 91%; Mouse: 91%; Pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.