GTF2H3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	general transcription factor IIH subunit 3
Database Link	NP_001507 Entrez Gene 2967 Human UniProt ID Q13889
Background	GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.
Synonyms	BTF2; P34; TFB4; TFIIH
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Basal transcription factors, Nucleotide excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.