Cyhr1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cyhr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	cysteine and histidine rich 1
Database Link	NP_851293 Entrez Gene 54151 Mouse UniProt ID Q9QXA1
Background	The function of Cyhr1 remains unknown.
Synonyms	CHRP; KIAA0496; MGC13010
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.