GTF2A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the C terminal of human GTF2A1. Synthetic peptide located within the following region: QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	general transcription factor IIA subunit 1
Database Link	NP_963889 Entrez Gene 2957 Human UniProt ID P52655
Background	Transcription initiation factor IIA . and . chains (GTF2A1, TFIIA p35 and p19 subunits, TFIIAL) binding ability of TLP is required for characteristic cytoplasmic localization of TLP. TFIIA may regulate the intracellular molecular state and the function of TLP through its property of binding to TLP.
Synonyms	TF2A1; TFIIA; TFIIA-42; TFIIAL
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Yeast: 91%; Zebrafish: 85%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Basal transcription factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.