HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HNF1A antibody is: synthetic peptide directed towards the C-terminal region of Human HNF1A. Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	HNF1 homeobox A
Database Link	NP_000536 Entrez Gene 6927 Human UniProt ID P20823
Background	The function of this protein remains unknown.
Synonyms	HNF-1A; HNF1; IDDM20; LFB1; MODY3; TCF-1; TCF1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 85%
Reference Data
Protein Families	Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways	Maturity onset diabetes of the young

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.