E74 like factor 1 (ELF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of human ELF1. Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	E74 like ETS transcription factor 1
Database Link	NP_001138825 Entrez Gene 1997 Human UniProt ID P32519
Background	ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.
Synonyms	E74-like factor 1 (ets domain transcription factor); OTTHUMP00000018310
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.