p53 (TP53) Rabbit Polyclonal Antibody

CAT#: TA329146

Rabbit Polyclonal anti-TP53 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications ELISA, WB
Recommend Dilution ELISA, WB, CHIP
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name tumor protein p53
Background TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Synonyms BCC7; LFS1; P53; TRP53
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Amyotrophic lateral sclerosis (ALS), Apoptosis, Basal cell carcinoma, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, Glioma, Huntington's disease, MAPK signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer, Thyroid cancer, Wnt signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...