Amphiregulin (AREG) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	amphiregulin
Database Link	NP_001648 Entrez Gene 374 Human UniProt ID P15514
Background	The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype.
Synonyms	AR; AREGB; CRDGF; SDGF
Note	Immunogen sequence homology: Human: 100%; Dog: 91%; Pig: 91%; Horse: 91%; Sheep: 91%; Bovine: 91%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ErbB signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.