TSC22 domain family, member 4 (TSC22D4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4. Synthetic peptide located within the following region: SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	TSC22 domain family member 4
Database Link	NP_112197 Entrez Gene 81628 Human UniProt ID Q9Y3Q8
Background	TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis.
Synonyms	THG-1; THG1; TILZ2
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 90%; Rat: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.