TFAP2D Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFAP2D antibody: synthetic peptide directed towards the C terminal of human TFAP2D. Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	transcription factor AP-2 delta
Database Link	NP_758438 Entrez Gene 83741 Human UniProt ID Q7Z6R9
Background	TFAP2D has significantly high homology to transcription factor AP-2 gene of human. It is highly expressed in adult thymus, prostate, small intestine, skeletal muscle, placenta, brain, and testis tissues
Synonyms	TFAP2BL1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.