BAF53b (ACTL6B) Mouse Monoclonal Antibody [Clone ID: N332B/15]

Specifications

Product Data
Clone Name	N332B/15
Applications	IF, IHC, WB
Recommend Dilution	Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC)
Reactivity	Human, Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (also known as 53 kDa BRG1-associated factor B, BRG1-associated factor 53B, Actin-like protein 6B, ArpNalpha, ACTL6B and ACTL6, accession number O94805). Mouse: 98% identity (75/76 amino acids identical). Rat: 98% identity (75/76 amino acids identical). >50% identity with BAF53a.
Specificity	Does not cross-react with BAF53a
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	actin like 6B
Database Link	Entrez Gene 51412 Human UniProt ID O94805
Synonyms	ACTL6, BAF53B, Actin-like protein 6B, ArpNalpha
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.