Kcnmb2 Mouse Monoclonal Antibody [Clone ID: N53/32]

Specifications

Product Data
Clone Name	N53/32
Applications	IF, IP, WB
Recommend Dilution	Immunoblot (IB) Immunocytochemistry (ICC) Immunoprecipitation (IP)
Reactivity	Human, Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 1-41 (MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALK, cytoplasmic N-terminus) and 218-235 (KLTQYLSLLCERIQRINR, cytoplasmic C-terminus) of mouse BKBeta2 (also known as BK channel subunit beta-2, Calcium-activated potassium channel subunit beta-2, Calcium-activated potassium channel, subfamily M subunit beta-2, Charybdotoxin receptor subunit beta-2, K(VCA)beta-2, Maxi K channel subunit beta-2, Slobeta-2 and Kcnmb2, accession number Q9CZM9). Human: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively) Rat: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively) <50% identity with other BKBeta subunits
Specificity	No cross-reactivity against BKBeta1, BKBeta3 or BKBeta4
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	potassium large conductance calcium-activated channel, subfamily M, beta member 2
Database Link	Entrez Gene 72413 Mouse UniProt ID Q9CZM9
Synonyms	BKbeta2, Hbeta2, Hbeta3, K(VCA)beta-2, Slo-beta-2
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.