KIR2.3 (KCNJ4) Mouse Monoclonal Antibody [Clone ID: N25/35]

Specifications

Product Data
Clone Name	N25/35
Applications	IF, IHC, WB
Recommend Dilution	Immunoblot (IB). Immunocytochemistry (ICC). Immunohistochemistry (IHC)
Reactivity	Human, Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 390-445 (cytoplasmic C-terminus, EAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI) of human Kir2.3 (also known as Inward rectifier potassium channel subfamily J member 4, KCNJ4, Brain inwardly rectifying K(+) channel 2, Hippocampal inward rectifier, HIRK2, HRK1, HIR, IRK3 and BIR11, accession number P48050). Mouse: 94% identity (54/57 amino acids identical) Rat: 94% identity (54/57 amino acids identical) <50% identity with Kir2.1 and Kir2.2
Specificity	Does not cross-react with Kir2.1 or Kir2.2
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	potassium voltage-gated channel subfamily J member 4
Database Link	Entrez Gene 3761 Human UniProt ID P48050
Synonyms	KCNJ4, Inward rectifier K(+) channel Kir2.3, Hippocampal inward rectifier, HIRK2, HRK1, HIR, Inward rectifier potassium channel 4
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.