Tsen54 (NM_029557) Mouse Recombinant Protein

CAT#: TP527588

Purified recombinant protein of Mouse tRNA splicing endonuclease subunit 54 (Tsen54), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227588 representing NM_029557
Red=Cloning site Green=Tags(s)

MEPEPEPGSVEVPAGRVLSASELRAARSRSQKLPQRSHGPKDFLPDGSEAQAERLRLCRQELWQLLAEER
VERLGSLVAAEWKPEEGFVELTSPAGKFWQTMGYSEEGRQRLHPEEALYLLECGSIQLFYQDLPLSIQEA
YQLLLTEDTLSFLQYQVFSHLKRLGYVVRRFQLSSVVSPYERQLNLDGYAQCLEDGSGKRKRSSSCRSVN
KKPKVLQNSLPPVSLAASSSPACDQSSQYPEEKSQDSSPRQGSELPLQFLGSSEPCSDLAREDVGCDRES
HKIENGAKGTPKLRWNFEQISFPNMASDSRHTFLPAPAPELLPANVIGRGTDAESWCQKLNQRREKLSRR
DREQQAVVQQFREDVNADPEVRGCSSWQEYKELLQRRQTQKSQPRPPHLWGQSVTPLLDPDKADCPAAVL
QHISVLQTTHLADGGYRLLEKSGGLQISFDVYQADAVATFRKNSPGKPYVRMCISGFDDPVPDLCSLKCL
TYQSGDVPLIFALVDHGDISFYSFRDFTLPRDLGH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083833
Locus ID 76265
UniProt ID Q8C2A2
Refseq Size 1972
Cytogenetics 11 E2
Refseq ORF 1575
Synonyms 0610034P02Rik
Summary Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...