Mknk2 (NM_021462) Mouse Recombinant Protein

CAT#: TP527130

Purified recombinant protein of Mouse MAP kinase-interacting serine/threonine kinase 2 (Mknk2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227130 representing NM_021462
Red=Cloning site Green=Tags(s)

MPSSQPIDIPDAKKRGRKKKRCRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCVNLITNQEYAVKIIEK
QLGHIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHRRRHFNELEASVVVQ
DVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYM
APEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGHCGSDCGWDRGEACPACQNMLFESIQEGKY
EFPDKDWSHISFAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPLVLQRNSCAKDLTSFAA
EAIAMNRQLAQCEEDAGQDQPVVIRATSRCLQLSPPSQSKLAQRRQRASLSATPVVLVGDRA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067437
Locus ID 17347
UniProt ID Q8CDB0
Refseq Size 3070
Cytogenetics 10 C1
Refseq ORF 1236
Synonyms 2010016G11Rik; Gprk7; Mnk; Mnk2
Summary The protein encoded by this gene is a serine/threonine-protein kinase, which is targeted by both the extracellular signal-regulated kinase and p38 mitogen-activated protein kinase pathways. This enzyme targets several substrates including eukaryotic translation initiation factor 4E and mammalian target of rapamycin, which are negatively regulated by its phosphorylation. Null mutant mice do not exhibit developmental or reproductive defects. However, mice null for both this protein and mitogen-activated protein kinase-interacting serine/threonine protein kinase 1 have delayed tumor development in phosphatase and tensin homolog mutant mice, indicating an oncogenic function for this gene in tumor development. [provided by RefSeq, Oct 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...