Tfcp2l1 (NM_023755) Mouse Recombinant Protein

CAT#: TP526633

Purified recombinant protein of Mouse transcription factor CP2-like 1 (Tfcp2l1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226633 protein sequence
Red=Cloning site Green=Tags(s)

MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENGARLPPLQYVLCAATSPAVKLHEETLTYLN
QGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEYQQLEGWRWSRPGDRILDIDIPLSVGI
LDPRASPTQLNAVEFLWDPSKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNESGDYSEHLHS
ASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVPYQANNTPSPSYNGSPN
SFGLREGNSSPNHPVEPLPLGSDHLLPSASIQDAQQWLHRNRFSQFCWLFASFSGADLLKMSRDDLVQVC
GPADGIRLFNAIKGRNVRPKMTIYVCQELEQNQLPLPQKQDDSGDNSLCVYHAIFLEELTTLELTEKIAS
LYSIPPQHIHRVYRQGPAGIHVVVSNEMVQNFQDESCFILSTLKAESNDGYHIILKCGL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_076244
Locus ID 81879
UniProt ID Q3UNW5
Refseq Size 9285
Cytogenetics 1 E2.3
Refseq ORF 1440
Synonyms 1810030F05Rik; 4932442M07Rik; AA575098; Cp2l1; Crtr-1; D930018N21Rik; LBP-9; Tcfcp2l1
Summary Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs) (PubMed:23942233, PubMed:26321140). With Klf2, acts as the major effector of self-renewal that mediates induction of pluripotency downstream of LIF/Stat3 and Wnt/beta-catenin signaling (PubMed:23942238, PubMed:23942233, PubMed:26321140). Required for normal duct development in the salivary gland and kidney (PubMed:17079272). Coordinates the development of the kidney collecting ducts intercalated (IC) and principal (PC) cells, which regulate acid-base and salt-water homeostasis, respectively (PubMed:28577314). Regulates the expression of IC genes including subunits B1 and D2 of the V-ATPase complex, Oxgr1, Ca12, Slc4a1, Aqp6 and IC-specific transcription factor Foxi1 (PubMed:28577314). Regulates also the expression of Jag1 and subsequent notch signaling in the collecting duct (PubMed:28577314). Jag1 initiates notch signaling in PCs but inhibits notch signaling in ICs (PubMed:28577314). Acts as a transcriptional suppressor that may suppress UBP1-mediated transcriptional activation (PubMed:11073954). Modulates the placental expression of CYP11A1 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...