Syce1 (NM_001143765) Mouse Recombinant Protein

CAT#: TP522211

Purified recombinant protein of Mouse synaptonemal complex central element protein 1 (Syce1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
SYCE1 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222211 representing NM_001143765
Red=Cloning site Green=Tags(s)

MATRPQPLGMEPEGSADLLHGPEGARGQYGSTQKIEDLMDMVKKLQKVGSLEPRIEVLINRINEVQQAKK
KASEELGEAQTVWDNLQKELDLLREEKVRLKDILNRKEETLRIMQLHCQEKESEAQRKHSMLQECKERIS
FLNSQIDKEKAKLRKLRLDFEEHLETLMSQHKDTLEFHKPEHLTKEMCVLDSSKEQLLKEEKLMKVKLED
VRQRLCALGGPEGSSSLIEGLFLRSHEAAAAMQMFKDENKKAEEFLEAAAQQHEQLQQRCHQLQQKRQRL
KEELEKHGVQILAHSTQNEEDSSWRMASPKPVEVHEETAQDQERPSSRT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001137237
Locus ID 74075
UniProt ID Q9D495
Refseq Size 1462
Cytogenetics 7
Refseq ORF 987
Synonyms 4933406J07Rik
Summary Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...