S100a6 (NM_011313) Mouse Recombinant Protein
CAT#: TP522185
Purified recombinant protein of Mouse S100 calcium binding protein A6 (calcyclin) (S100a6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR222185 representing NM_011313
Red=Cloning site Green=Tags(s) MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNF QEYVAFLGALALIYNEALK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 10.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035443 |
Locus ID | 20200 |
UniProt ID | P14069 |
Refseq Size | 719 |
Cytogenetics | 3 39.35 cM |
Refseq ORF | 267 |
Synonyms | 2A9; 5B10; Cacy; CALCYCLIN; PRA |
Summary | May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |