Gimap1 (NM_175860) Mouse Recombinant Protein

CAT#: TP521664

Purified recombinant protein of Mouse GTPase, IMAP family member 1 (Gimap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221664 protein sequence
Red=Cloning site Green=Tags(s)

MGGRKMARDEEDAYGSEDSRAPQMPQLRLILVGRTGTGKSATGNSILGQKCFLSRLGAVPVTRSCTLASR
MWAGWQVEVVDTPDIFSSEIPRTDPGCVETARCFVLSAPGPHALLLVTQLGRFTMQDSQALAAVKRLFGK
QVMARTVVVFTRQEDLAGDSLQDYVHCTDNRALRDLVAECGGRVCALNNRATGSEREAQAEQLLGMVACL
VREHGGAHYSNEVYELVQDTRCADPQDQVAKVAEIVAERMQRRTRLLAGLWGWRKFYWKGWRRGFSVFLG
VAILIYLLFYRKGFGDQNNR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_787056
Locus ID 16205
UniProt ID Q3TFI6
Refseq Size 1499
Cytogenetics 6 B2.3
Refseq ORF 903
Synonyms 38kD; i; IA; IAP38; Ima; imap; Imap38
Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. Sequence analysis identified two alternatively spliced variants that encode the same protein. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...