Birc7 (NM_001163247) Mouse Recombinant Protein

CAT#: TP521467

Purified recombinant protein of Mouse baculoviral IAP repeat-containing 7 (livin) (Birc7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221467 representing NM_001163247
Red=Cloning site Green=Tags(s)

MFSPADLFRAAVFSMGPESRARDSVRGPELSHREDGSGRTQEQDKPHCPCNHVLGQDCLDGQILGQLRPL
SEEEESSGAAFLGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSW
ERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQTYTPLLGSWDQREEPEDAVSATPSAPAHGSPELLRSR
RETQPEDVSEPGAKDVQEQLRQLQEERRCKVCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCV
RTFLS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001156719
Locus ID 329581
UniProt ID A2AWP0
Refseq Size 1178
Cytogenetics 2 H4
Refseq ORF 855
Synonyms E130019N06; KIAP; Livin; ML-IAP
Summary Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic activity is mediated through the inhibition of caspase-3, -7, and -9, as well as by its E3 ubiquitin-protein ligase activity. As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival. May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions. Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...